FastA does a Pearson and Lipman search for similarity between a query sequence and a group of sequences of the same type (nucleic acid or protein). For nucleotide searches, FastA may be more sensitive than BLAST.
FastA uses the method of Pearson and Lipman (Proc. Natl. Acad. Sci. USA 85; 2444-2448 (1988)) to search for similarities between one sequence (the query) and any group of sequences of the same type (nucleic acid or protein) as the query sequence.
In the first step of this search, the comparison can be viewed as a set of dot plots, with the query as the vertical sequence and the group of sequences to which the query is being compared as the different horizontal sequences. This first step finds the registers of comparison (diagonals) having the largest number of short perfect matches (words) for each comparison. In the second step, these "best" regions are rescored using a scoring matrix that allows conservative replacements, ambiguity symbols, and runs of identities shorter than the size of a word. In the third step, the program checks to see if some of these initial highest-scoring diagonals can be joined together. Finally, the search set sequences with the highest scores are aligned to the query sequence for display.
A word is any short sequence (n-mer or k-tuple) where you have set
n to some small integer less than or equal to six. The word GGATGG is one
of the 4,096 possible words of length six that can be created from an alphabet
consisting of the four letters G, A, T, and C. The word QL is one of the
400 possible words of length two that you can make with the 20 letters
of the amino acid alphabet.
Here is a session using FastA to identify sequences in the PIR protein sequence database that are similar to a human globin protein sequence:
% fasta FASTA with what query sequence ? ggamma.pep Removing terminal * from query sequence... Begin (* 1 *) ? End (* 147 *) ? Search for query in what sequence(s) (* PIR:* *) ? What word size (* 2 *) ? Don't show scores whose E() value exceeds: (* 10.0 *): What should I call the output file (* ggamma.fasta *) ? 1 Sequences 105 aa searched PIR1:CCHU 501 Sequences 93,217 aa searched PIR1:IHQFT /////////////////////////////////////////////////// CPU time used: Database scan: 0:01:14.3 Post-scan processing: 0:00: 6.2 Total CPU time: 0:01:20.6 Output File: ggamma.fasta %
The output from FastA is a list file, and is suitable for input to any GCG program that allows indirect file specifications. (For information about indirect file specification, see Chapter 2, Using Sequence Files and Databases of the User's Guide.)
Here is some of the output file:
!!SEQUENCE_LIST 1.0 (Peptide) FASTA of: ggamma.pep from: 1 to: 147 September 25, 1998 11:18 TRANSLATE of: gamma.seq check: 6474 from: 2179 to: 2270 and of: gamma.seq check: 6474 from: 2393 to: 2615 and of: gamma.seq check: 6474 from: 3502 to: 3630 generated symbols 1 to: 148. Human fetal beta globins G and A gamma from Shen, Slightom and Smithies, Cell 26; 191-203. . . . TO: PIR:* Sequences: 109,075 Symbols: 34,814,664 Word Size: 2 Databases searched: NBRF, Release 57.0, Released on 30Jun1998, Formatted on 18Aug1998 Scoring matrix: GenRunData:Blosum50.Cmp Variable pamfactor used Gap creation penalty: 12 Gap extension penalty: 2 Histogram Key: Each histogram symbol represents 179 search set sequences Each inset symbol represents 17 search set sequences z-scores computed from opt scores z-score obs exp (=) (*) < 20 863 0:===== 22 0 0: 24 0 0: 26 2 2:* 28 14 25:* 30 81 149:* 32 306 577:== * 34 1045 1564:====== * 36 2925 3213:=================* 38 5368 5310:=============================* 40 7971 7407:=========================================*=== 42 9957 9054:==================================================*===== 44 10706 9987:=======================================================*==== 46 10069 10172:========================================================* 48 9611 9739:======================================================* 50 8595 8887:=================================================* 52 7636 7813:===========================================* 54 6559 6674:=====================================* 56 5262 5574:============================== * 58 4590 4576:=========================* 60 3638 3707:====================* 62 2916 2972:================* 64 2320 2364:=============* 66 1907 1868:==========* 68 1368 1469:========* 70 1122 1152:======* 72 837 900:=====* 74 631 702:===* 76 483 546:===* 78 349 424:==* 80 299 330:=* 82 213 252:=* 84 132 200:=* 86 112 155:* 88 87 120:* 90 74 93:* 92 47 72:* :=== * 94 27 55:* :== * 96 29 43:* :==* 98 25 33:* :=* 100 24 26:* :=* 102 9 20:* :=* 104 11 15:* :* 106 6 12:* :* 108 7 9:* :* 110 4 7:* :* 112 3 6:* :* 114 2 4:* :* 116 3 3:* :* 118 1 3:* :* >120 829 2:*==== :*======================================= Joining threshold: 36, opt. threshold: 24, opt. width: 16, reg.-scaled The best scores are: init1 initn opt z-sc E(108291).. PIR1:HGCZG ! hemoglobin gamma-G chain - chimpanzee 971 971 971 1145.0 6.2e-57 PIR1:I37025 ! hemoglobin gamma-G chain - gorilla 971 971 971 1145.0 6.2e-57 PIR1:HGHUG ! hemoglobin gamma-G chain - human 971 971 971 1145.0 6.2e-57 ////////////////////////////////////////////////////////////////////////// \\End of List ggamma.pep PIR1:HGCZG P1;HGCZG - hemoglobin gamma-G chain - chimpanzee N;Alternate names: hemoglobin gamma-1 chain C;Species: Pan troglodytes (chimpanzee) C;Date: 31-May-1996 #sequence_revision 21-Jan-1997 #text_change 14-Nov-1997 C;Accession: I36939; I61853 R;Slightom, J.L.; Chang, L.Y.; Koop, B.F.; Goodman, M. . . . SCORES Init1: 971 Initn: 971 Opt: 971 z-score: 1145.0 E(): 6.2e-57 Smith-Waterman score: 971; 100.0% identity in 147 aa overlap 10 20 30 40 50 60 ggamma.pep MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| HGCZG MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPK 10 20 30 40 50 60 70 80 90 100 110 120 ggamma.pep VKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| HGCZG VKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFG 70 80 90 100 110 120 130 140 ggamma.pep KEFTPEVQASWQKMVTGVASALSSRYH ||||||||||||||||||||||||||| HGCZG KEFTPEVQASWQKMVTGVASALSSRYH 130 140 ///////////////////////////////////////////////////////////////////////// ! Distributed over 1 thread. ! Start time: Fri Sep 25 11:15:55 1998 ! Completion time: Fri Sep 25 11:30:38 1998 ! CPU time used: ! Database scan: 0:01:14.3 ! Post-scan processing: 0:00:06.2 ! Total CPU time: 0:01:20.6 ! Output File: ggamma.fasta
The first part of the output file contains a histogram showing the
distribution of the z-scores
between the query and search set sequences.
(See the ALGORITHM topic for an explanation of z-score.) The histogram
is composed of bins of size 2 that are labeled according to the higher
score for that bin (the leftmost column of the histogram). For example,
the bin labeled 24 stores the number of sequence pairs that had scores
of 23 or 24.
The next two columns of the histogram list the number of z-scores that fell within each bin. The second column lists the number of z-scores observed in the search and the third column lists the number of z-scores that were expected.
The body of the histogram displays a graphical representation of the score distributions. Equal signs (=) indicate the number of scores of that magnitude that were observed during the search, while asterisks (*) plot the number of scores of that magnitude that were expected.
At the bottom of the histogram is a list of some of the parameters pertaining to the search.
Below the histogram, FastA displays a listing of the best scores. Strand:- after the sequence name in this list indicates that the match was found between the search set sequence and the reverse complement of the query sequence.
Following the list of best scores, FastA displays the alignments of the regions of best overlap between the query and search sequences. /rev following the query sequence name indicates that the search sequence is aligned with the reverse complement of the query sequence.
This program displays only the region of overlap between the two aligned sequences (plus some residues on either side of the region to provide context for the alignment) unless you use -SHOWall. The display of identities and conservative replacements between the aligned sequences depends on the value of -MARKx. By default ( -MARKx=3), the pipe character (|) is used to denote identities and the colon (:) to denote conservative replacements.
FastA accepts a single protein sequence or a single nucleic acid sequence as the query sequence. The search set is either a single sequence or multiple sequences of the same type as the query. You can specify multiple sequences in a number of ways: by using a list file, for example @project.list; by using an MSF or RSF file, for example project.msf{*}; or by using a sequence specification with an asterisk (*) wildcard, for example GenEMBL:*. The function of FastA depends on whether your input sequence(s) are protein or nucleotide. Programs determine the type of a sequence by the presence of either Type: N or Type: P on the last line of the text heading just above the sequence. If your sequence(s) are not the correct type, turn to Appendix VI for information on how to change or set the type of a sequence.
BLAST searches one or more nucleic acid or protein databases for sequences similar to one or more query sequences of any type. BLAST can produce gapped alignments for the matches it finds. NetBLAST searches for sequences similar to a query sequence. The query and the database searched can be either peptide or nucleic acid in any combination. NetBLAST can search only databases maintained at the National Center for Biotechnology Information (NCBI) in Bethesda, Maryland, USA.
SSearch does a rigorous Smith-Waterman search for similarity between a query sequence and a group of sequences of the same type (nucleic acid or protein). This may be the most sensitive method available for similarity searches. Compared to BLAST and FastA, it can be very slow.
TFastA does a Pearson and Lipman search for similarity between a protein query sequence and any group of nucleotide sequences. TFastA translates the nucleotide sequences in all six reading frames before performing the comparison. It is designed to answer the question, "What implied protein sequences in a nucleotide sequence database are similar to my protein sequence?"
TFastX does a Pearson and Lipman search for similarity between a protein query sequence and any group of nucleotide sequences, taking frameshifts into account. It is designed to be a replacement for TFastA, and like TFastA, it is designed to answer the question, "What implied protein sequences in a nucleotide sequence database are similar to my protein sequence?"
FastX does a Pearson and Lipman search for similarity between a nucleotide query sequence and a group of protein sequences, taking frameshifts into account. FastX translates both strands of the nucleic sequence before performing the comparison. It is designed to answer the question, "What implied protein sequences in my nucleic acid sequence are similar to sequences in a protein database?"
FrameSearch searches a group of protein sequences for similarity to one or more nucleotide query sequences, or searches a group of nucleotide sequences for similarity to one or more protein query sequences. For each sequence comparison, the program finds an optimal alignment between the protein sequence and all possible codons on each strand of the nucleotide sequence. Optimal alignments may include reading frame shifts.
WordSearch identifies sequences in the database that share large numbers of common words in the same register of comparison with your query sequence. The output of WordSearch can be displayed with Segments.
ProfileSearch and MotifSearch use a profile (derived from a set of aligned sequences) instead of a query sequence to search a collection of sequences. FindPatterns uses a pattern described by a regular expression to search a collection of sequences.
StringSearch, LookUp, and Names identify sequences by searching the annotation (non-sequence) portions of seqence files or sequence databases.
The query sequence cannot be longer than 32,000 symbols. You cannot select a list size of more than 1,000 best scores nor view more than 1,000 alignments. The word size must be from 1 to 6 for nucleic acid queries, and from 1 to 2 for protein queries. The sequence type (nucleic acid or protein) of the query sequence and the search set sequences must match.
For the estimates of statistical significance to be valid, the search set must contain a large sample of unrelated sequences. The statistical estimates will not be calculated at all if there are fewer 10 sequences in the search set (20 sequences if only one strand is searched).
With -NOOPTall, the estimates of statistical significance will not be accurate.
FastA uses the method of Pearson and Lipman (Proc. Natl. Acad. Sci. USA 85; 2444-2448 (1988)) to search for similarities between one sequence (the query) and any group of sequences.
The first step in the search is to locate regions of the query sequence
and the search set sequence that have high densities of exact word
matches. The algorithm for this step of the search is a modification of
the algorithm of Wilbur and Lipman (Proc. Natl. Acad. Sci. USA 80;
726-730 (1983)) and may be referred to as a hash-table look-up search
or hashing. Wilbur and Lipman searches (including FastA) belong
to a class of comparisons that use direct addressing or k-tuple
preprocessing to increase the speed of the search at the expense of
some sensitivity.
The hashing process works as follows. After you give FastA a word size, it makes up a dictionary of all of the possible words of that size in the query sequence. A second dictionary is created for the opposite strand if the query is a nucleic acid sequence. Each word, such as GGATGG, is converted to a unique base-4 number that serves as an index to the corresponding dictionary entry. Each entry contains a list of numbers telling the location (coordinates) of the word in the query sequence. If the word does not occur, the entry contains only the number zero. So for each word in the searched sequences, FastA only has to look up the word in the dictionary to find out if it occurs in the query sequence.
It is important to realize that the hashing process cannot deal with ambiguity! To partially compensate for this limitation, FastA converts an ambiguous base in a sequence to its most common nonambiguous constituent before calculating the index number of the word that contains the ambiguity. For example, A is the most common nucleotide in the sequence databases, so N is converted to A during the hashing step. Similarly, the ambiguous amino acids B, Z, and X are converted to their most common unambiguous constituent, so B (D or N) gets the same hash code as N, and X (any amino acid) gets the same hash code as alanine, the most common amino acid in the protein databases.
If a word from a search set sequence occurs in the query sequence, FastA computes a score for the word equal to the sum of the scoring factors (see next paragraph) for each symbol in the word. It then adds this score to the score of the diagonal on which the word occurs. If a word match overlaps another word on the same diagonal, only the scoring factor(s) for the non-overlapping symbol(s) is added to the score of the diagonal. If there are intervening mismatches between matching words on a diagonal, a constant penalty for each mismatching residue is subtracted from the score.
When -PAMfactor is in effect (the default for protein query sequences), the scoring factors used to score a word are the identical match scores of the scoring matrix used. Thus a word that contains relatively immutable amino acids will add a larger score to the diagonal than a word which contains amino acids which can exchange readily. The default for a nucleic acid query sequence is -NOPAMfactor. In this case, a single constant value is used for all symbol matches, so all words contribute the same score. The program defaults can be overridden using -PAMfactor or -NOPAMfactor.
At the end of the hashing step, the ten highest-scoring regions
for the sequence pair (the regions with the highest density of exact word
matches) are rescored using a scoring matrix that allows conservative replacements
and runs of identities shorter than the size of a word. The ends of each
region are trimmed to include only those residues that contribute to the
highest score for the region, resulting in ten partial alignments without
gaps. These are referred to as the initial regions. The score of the highest
scoring initial region is saved as the init1 score.
Next, FastA determines if any of the initial regions from different diagonals may be joined together to form an approximate alignment with gaps. Only non-overlapping regions may be joined. The score for the joined regions is the sum of the scores of the initial regions minus a joining penalty for each gap. The score of the highest scoring region at the end of this step is saved as the initn score.
After computing the initial scores, FastA determines the best segment
of similarity between the query sequence and the search set sequence, using
a variation of the Smith-Waterman algorithm. This "local alignment in a
band" procedure is described in Chao, Pearson, and Miller (CABIOS 8;
481-487 (1992)). The score for this alignment is reported as the opt
score.
By default, FastA determines the opt score immediately if the initn score is greater than a given threshold. The opt scores are then used as the basis for keeping a list of the best matches found. The program calculates the default threshold from the length of the query sequence and the ktup setting. You can override this threshold by adding a positive, nonzero number after -OPTall, for example -OPTall=20. A threshold of 1 is the most sensitive setting. Setting the threshold higher than this will speed up the search, at the risk of missing some matches.
Alternatively, you can use -NOOPTall to direct the program to use the initn scores as the basis for retaining the best matches. In this case, the opt scores are calculated for the matches with the best initn scores only after all of the search set sequences have been scanned. This speeds up the search, but at the cost of sensitivity, and the statistical estimates for such a search will not be valid. When -NOOPTall is specified, the best scores are sorted and reported in order of their initn scores, even though the opt score is calculated.
Lastly, FastA uses a simple linear regression against the natural log of the search set sequence length to calculate a normalized z-score for the sequence pair. (See William R. Pearson, Protein Science 4; 1145-1160 (1995) for an explanation of how this z-score is calculated.) By default, the z-score is calculated from the opt score; with -NOOPTall, the z-score is calculated from the initn score instead.
The distribution of the z-scores tends to closely approximate an extreme-value distribution; using this distribution, the program can estimate the number of sequences that would be expected to have, purely by chance, a z-score greater than or equal to the z-score obtained in the search. This is reported as the E() score.
In evaluating the E() scores, the following rules of thumb can be used: for searches of a protein database of 10,000 sequences, sequences with E() less than 0.01 are almost always found to be homologous. Sequences with E() between 1 and 10 frequently turn out to be related as well. Optimization is important: with -NOOPTall, E() overestimates the significance of the match, so that unrelated nucleic acid sequences frequently have scores less than 0.0005.
A detailed description of the FastA algorithm is William R. Pearson, "Rapid and Sensitive Sequence Comparison with FASTP and FASTA," in Methods in Enzymology, 183; 63-98, Academic Press, San Diego, California, USA, 1990.
The Wisconsin Package(TM) version of FastA searches using both strands of nucleic acid queries unless you use -ONEstrand. Dr. Pearson's FASTA searches with one strand only.
The E() scores are affected by similarities in sequence composition between the query sequence and the search set sequence. Unrelated sequences may have "significant" scores because of composition bias.
If there is a database entry that overlaps your query in several places, but there are large gaps between the matching regions, only the best overlap appears in the alignment display.
There are two ways to control the size of the list of best scores. By default, scores are listed until a specific E() value is reached. You may set the value in response to the program prompt or by using -EXPect; otherwise the program uses 10.0 for protein searches, 2.0 for nucleic acid searches. (If you are running the program interactively, it will show no more than 40 scores initially, and ask if you want to see more scores if there are any more that are less than the E() value.)
If you use -LIStsize, the E() value is ignored, and the program will list the number of scores you requested.
You can control the number of alignments using -NOALIgn and -ALIgn. The program behaves differently depending on whether it is being run noninteractively (in batch or with -Default on the command line) or interactively. In the noninteractive case, the program displays the number of alignments set by -ALIgn. (If this is not present, it shows 40 alignments or the number of scores that were listed, whichever is smaller.) If you run the program interactively, it displays the list of best scores, then asks you how many alignments you want to see. (This prompt does not appear if you use -NOALIgn or -ALIgn.)
By default, FastA uses the maximum allowable word size in order
to maximize the speed of the search. But in some situations this may not
be sensitive enough to find matches to your query. In particular, if your
query sequence is a short oligonucleotide or peptide and/or the query contains
ambiguous residues, you may need to use -WORdsize to reduce
the word size that is used during the hashing step. (A smaller word size
will increase the sensitivity of the search at the expense of increasing
the amount of CPU time required to run the program.)
If FastA finds few or no matches for short query sequences, rerun the search using a word size of 2 or 3 (for oligonucleotides) or a word size of 1 (for short peptides). Because of the way ambiguous residues are treated during the hashing stage of the search, you should not use a word size larger than the longest run of nonambiguous residues in your query sequence .
Unlike other GCG programs, FastA does not read the default gap creation
and gap extension penalties from the scoring matrix file. It uses default
gap creation and extension penalties that were empirically determined to
be appropriate for the default scoring matrices. If you select a different
scoring matrix with -MATRix, you may need to change the
gap penalties. The histogram display gives a qualitative view of the quality
of fit between the actual distribution of scores and the expected distribution
of scores. This information may indicate whether or not suitable gap creation
and extension penalties were used for the search. When the histogram shows
poor agreement between the actual distribution and the theoretical distribution,
you might consider using -GAPweight and/or -LENgthweight
to specify higher gap creation and extension penalties, respectively. For
example, you might increase the gap creation penalty from 12 to 16 and
the gap extension penalty from 2 to 4.
There are two different philosophies on how to penalize gaps in
an alignment. One way is to penalize a gap by the gap creation penalty
plus the extension penalty times the length of the gap (gapweight +
(lengthweight x gap length)). The other way is to use the gap creation
penalty plus the extension penalty times the gap length excluding the
first residue in the gap (gapweight + (lengthweight x (gap length
- 1)).
"Native" GCG programs, such as Framesearch and Bestfit, handle gap extension penalties the first way, while the FastA-family programs use the second way. Therefore a value for -LENgthweight that gives good results with one of the FastA-family programs may not give equivalent results with a native GCG program, and vice versa.
This program is multithreaded. It has the potential to run faster
on a machine equipped with multiple processors because different parts
of the analysis can be run in parallel on different processors. By default,
the program assumes you have one processor, so the analysis is performed
using one thread. You can use -PROCessors to increase the
number of threads up to the number of physical processors on the computer.
Under ideal conditions, the increase in speed is roughly linear with the number of processors used. But conditions are rarely ideal. If your computer is heavily used, competition for the processors can reduce the program's performance. In such an environment, try to run multithreaded programs during times when the load on the system is light.
As the number of threads increases, the amount of memory required increases substantially. You may need to ask your system administrator to increase the memory quota for your account if you want to use more than two threads.
Never use -PROCessors to set the number of threads higher than the number of physical processors that the machine has -- it does not increase program performance, but instead uses up a lot of memory needlessly and makes it harder for other users on the system to get processor time. Ask your system administrator how many processors your computer has if you aren't sure.
If you want to search a single database division instead of an entire
database, see the "Using Database Sequences" topic of Chapter 2, Using
Sequence Files and Databases of the User's Guide for a list of the logical
names used for the databases and the divisions of each database. The search
set can also consist of a group of sequence files that are not in a database.
Use a multiple sequence specification to name these. For information about
naming groups of sequences for the search set, see the topics "Specifying
Files" and "Using Wildcards" in Chapter 1, Getting Started, and "Using
Database Sequences," "Using Multiple Sequence Format (MSF) Files", "Using
Rich Sequence Format (RSF) Files", and "Using List Files" in Chapter 2,
Using Sequence Files and Databases of the User's Guide.
FastA is one of the few programs in the Wisconsin Package that can
take more than a few minutes to run. Most comparisons should probably be
run in the batch queue. You can specify that this program run at a later
time in the batch queue by using -BATch. Run this way,
the program prompts you for all the required parameters and then automatically
submits itself to the batch or at queue. For more information, see "Using
the Batch Queue" in Chapter 3, Using Programs in the User's Guide.
Very large comparisons may exceed the CPU limit set by some systems.
You can type <Ctrl>C to interrupt a search and see the results
from the part of the search that has already been completed. Because the
program is multithreaded, the search may not be interrupted immediately,
but will continue until one of the threads finishes processing its data
and returns for more data.
The FASTA program family (FastA, TFastA, FastX, TFastX, and SSearch) was written by Professor William Pearson of the University of Virginia Department of Biochemistry (Pearson and Lipman, Proc. Natl. Acad. Sci., USA 85; 2444-2448 (1988)). In collaboration with Dr. Pearson, the programs were modified and documented for distribution with Wisconsin Package Version 6.1 by Mary Schultz and Irv Edelman, and for Versions 8 through 10 by Sue Olson.
All parameters for this program may be added to the command line. Use -CHEck to view the summary below and to specify parameters before the program executes. In the summary below, the capitalized letters in the parameter names are the letters that you must type in order to use the parameter. Square brackets ([ and ]) enclose parameter values that are optional. For more information, see "Using Program Parameters" in Chapter 3, Using Programs in the User's Guide.
Minimal Syntax: % fasta [-INfile1=]ggamma.pep -Default Prompted Parameters: [-INfile2=]pir:* specifies the search set [-OUTfile=]ggamma.fasta specifies the output file name -BEGin=1 -END=148 sets the range of interest -WORdsize=2 sets the word size -EXPect=2.0 lists scores until E() value reaches 2.0 Local Data Files: -MATRix=fastadna.cmp assigns the scoring matrix for nucleic acids -MATRix=blosum50.cmp assigns the scoring matrix for proteins Optional Parameters: -PROCessors=2 sets the number of threads devoted to the analysis on a multiprocessor computer -MINLength=1000 searches only sequences of 1000 or more residues -MAXLength=5000 searches only sequences of 5000 or fewer residues -SINce=6.90 limits search to sequences dated on or after June 1990 -ONEstrand searches using only the top strand of nucleotide queries -PAMfactor uses scoring matrix to calculate initial diagonal scores -GAPweight=16 sets gap creation penalty (12 is protein default) -LENgthweight=4 sets gap extension penalty (2 is protein default) -OPTall=20 computes opt score when the initn score is 20 or higher; sorts on opt score -NOOPTall doesn't compute opt score during search; sorts on initn -SWalign creates final alignment as unlimited Smith-Waterman for nuc -LIStsize=40 shows the best 40 scores (overrides EXPect) -ALIgn=20 shows the best 20 alignments -NOALIgn suppresses sequence alignments -SHOWall shows complete sequences in alignment, not just overlaps -MARKx=3 sets the alignment display mode -NOHIStogram suppresses printing the histogram -LINesize=60 sets number of sequence symbols per line of the alignment -NODOCLines suppresses sequence documentation in the alignment -BATch submits the program to run in the batch queue -NOMONitor suppresses the screen trace for each search set sequence
The files described below supply auxiliary data to this program. The program automatically reads them from a public data directory unless you either 1) have a data file with exactly the same name in your current working directory; or 2) name a file on the command line with an expression like -DATa1=myfile.dat. For more information see Chapter 4, Using Data Files in the User's Guide.
This program reads one or more scoring matrices for the comparison
of sequence characters. The program automatically reads the program's default
scoring matrix in a public data directory unless you either 1) have a data
file with exactly the same name as the program default scoring matrix in
your current working directory; or 2) have a data file with exactly the
same name as the program default scoring matrix in the directory with the
logical name MyData; or 3) name a file on the command line with an expression
like -MATRix=mymatrix.cmp. If you don't include
a directory specification when you name a file with -MATRix,
the program searches for the file first in your local directory, then in
the directory with the logical name MyData, then in the public data directory
with the logical name GenMoreData, and finally in the public data directory
with the logical name GenRunData. For more information see "Using a Special
Kind of Data File: A Scoring Matrix" in Chapter 4, Using Data Files in
the User's Guide.
FastA reads a scoring matrix containing the values for every possible match from your working directory or the public database. The files fastadna.cmp (for nucleic acid sequences) and blosum50.cmp (for protein sequences) contain the default values for matches. blosum50.cmp is a BLOSUM50 matrix. You can use the Fetch program to obtain a copy of these files in order to modify them to suit your own needs.
You can set the parameters listed below from the command line. For more information, see "Using Program Parameters" in Chapter 3, Using Programs in the User's Guide.
sets the size of the word (k-tuple) to use for the hashing step.
allows you to specify a scoring matrix file name other than the
program default. If you don't include a directory specification when you
name a file with -MATRix, the program searches for the
file first in your local directory, then in the directory with the logical
name MyData, then in the public data directory with the logical name GenMoreData,
and finally in the public data directory with the logical name GenRunData.
For more information see the Local Scoring Matrices section.
shows all scores whose E() value is less than 2.0. Ignored if
-LIStsize is used.
tells the program to use 2 threads for the database search on a
multiprocessor computer.
restricts the search to search set sequences that are equal to or
longer than 1000 residues.
restricts the search to search set sequences that are equal to or
shorter than 5000 residues.
limits the search to sequences that have been entered into the database
or modified since June 1990. As this is being written, only the EMBL, GenBank,
and SWISS-PROT databases support this parameter.
searches using only the top strand of a nucleotide query sequence.
uses a scoring matrix for the calculation of initial diagonal scores.
Instead of using a constant factor for each match in a word, values are
obtained from a scoring matrix. This is the default option for protein
sequences, while -NOPAMfactor is the default for nucleic
acid sequences.
specifies the gap creation penalty that is subtracted from the alignment
score whenever a gap is created.
specifies the gap extension penalty that is subtracted from the
alignment score for each residue added to an existing gap.
immediately performs an alignment and calculates the opt score when
the initn score is greater than or equal to 20. This parameter allows you
to override the default threshold calculated by the program. Scores are
sorted and saved by opt score during the search. -NOOPTall
doesn't compute the opt score until the search is complete. In this case
scores are sorted and saved by initn score instead of by opt score.
does an unlimited Smith-Waterman alignment as the final alignment
for nucleotide searches, instead of the "alignment in a band" version of
Smith-Waterman. (Note: this can be very slow.)
shows the best 40 scores. Overrides -EXPect.
limits the number of alignments to display in the output file to
the 10 best matches in the list. Use the -NOALIgn to suppress
the sequence alignments in the output file.
shows entire sequences in the alignment display, instead of just
the best region of overlap and its surroundings.
determines the alignment display mode -- especially the symbols
that identify matches and mismatches. The default value, 3, uses a pipe
character (|) to show identities and a colon (:) to show conservative replacements.
-MARKx=0 uses a colon to show identities and a period (.)
to show conservative replacements. -MARKx=1 will
not mark identities; instead, conservative replacements are connected with
a lowercase x, and non-conservative substitutions are connected with an
uppercase X. If -MARKx=2, the residues in the second
sequence are shown only if they differ from the first sequence.
Use -MARKx=10 to get aligned sequences in the FastA "parsable" output format. A document describing this format appears after FastA in the Program Manual.
suppresses printing the histogram.
lets you set the number of sequence symbols in each line of the
alignment to any number between 60 and 200.
suppresses the documentation from the search set sequence accompanying
the alignment in the output file. Use -DOCLines=5
to copy only five non-blank lines of documentation.
submits the program to the batch queue for processing after prompting
you for all required user inputs. Any information that would normally appear
on the screen while the program is running is written into a log file.
Whether that log file is deleted, printed, or saved to your current directory
depends on how your system manager has set up the command that submits
this program to the batch queue. All output files are written to your current
directory, unless you direct the output to another directory when you specify
the output file.
monitors this program's progress on your screen. Use this parameter
to see this same monitor in the log file for a batch process. If the monitor
is slowing down the program because your terminal is connected to a slow
modem, suppress it with -NOMONitor.
The monitor is updated every time the program processes 500 sequences or files. You can use a value after the parameter to set this monitoring interval to some other number.
[ Program Manual | User's Guide | Data Files | Databases ]
Technical Support: support-us@accelrys.com
or support-eu@accelrys.com
Copyright (c) 1982-2002 Accelrys Inc. A subsidiary of Pharmacopeia, Inc. All rights reserved.
Licenses and Trademarks Wisconsin Package is a trademark and GCG and the GCG logo are registered trademarks of Accelrys Inc.
All other product names mentioned in this documentation may be trademarks, and if so, are trademarks or registered trademarks of their respective holders and are used in this documentation for identification purposes only.