It also reports the Pubmed IDs of papers that might be related to your sequence, published on the last 20 days.

The search is performed when new data appears at the target sites, and you are notified by email to the email address provided at the time of initiating a request.

A request is valid for a period of 3 months. You will be notified by email of this fact, and will be able to renew the request for another period, as many times as you want.

Bulk SeqAlert request by email: You may start a SeqAlert request for one or several sequences by sending an email to seqalert@weizmann.ac.il, including in the mail text (NOT an attached file) one or more sequences in FASTA format, separated by empty line(s).
The SeqAlert will be "owned" by the email address that sends the email. You may set the email owner for the bulk request by inserting a line like this at the beginning of the email text:

email = user@some.university.edu

A sequence in FASTA format begins with a single-line description, followed by lines of sequence data. The description line is distinguished from the sequence data by a greater-than (">") symbol in the first column. It is recommended that all lines of text be shorter than 80 characters in length. Example:

>2ace_ mol:protein length:537 Native AChE From Torpedo Californica
DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQF
PGFSGSEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRV
GAFGFLALHGSQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQ
SGSPNCPWASVSVAEGRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEF
FPTSLESMLNSGNFKKTQILLGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQY
TDWMDDNNGIKNRDGLDDIVGDHNVICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGL
PLVKELNYTAEEEALSRRIMHYWATFAKTGNPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWN
QFLPKLLNATAC

Send questions, suggestions and comments to Jaime.Prilusky@weizmann.ac.il