>2oxj_A mol:protein length:34 hybrid alpha/beta peptide based on the GCN4-p1 sequence; heptad positions b and f substituted with beta-amino acids XRMKQLEDKVEELLSKNYHLENEVARLKKLVXER >2oxj_C mol:protein length:34 hybrid alpha/beta peptide based on the GCN4-p1 sequence; heptad positions b and f substituted with beta-amino acids XRMKQLEDKVEELLSKNYHLENEVARLKKLVXER >2oxj_B mol:protein length:34 hybrid alpha/beta peptide based on the GCN4-p1 sequence; heptad positions b and f substituted with beta-amino acids XRMKQLEDKVEELLSKNYHLENEVARLKKLVXER >2oxj_C mol:protein length:34 hybrid alpha/beta peptide based on the GCN4-p1 sequence; heptad positions b and f substituted with beta-amino acids XRMKQLEDKVEELLSKNYHLENEVARLKKLVXER