>2oxj_A mol:protein length:34  hybrid alpha/beta peptide based on the GCN4-p1 sequence; heptad positions b and f substituted with beta-amino acids
XRMKQLEDKVEELLSKNYHLENEVARLKKLVXER
>2oxj_C mol:protein length:34  hybrid alpha/beta peptide based on the GCN4-p1 sequence; heptad positions b and f substituted with beta-amino acids
XRMKQLEDKVEELLSKNYHLENEVARLKKLVXER
>2oxj_B mol:protein length:34  hybrid alpha/beta peptide based on the GCN4-p1 sequence; heptad positions b and f substituted with beta-amino acids
XRMKQLEDKVEELLSKNYHLENEVARLKKLVXER
>2oxj_C mol:protein length:34  hybrid alpha/beta peptide based on the GCN4-p1 sequence; heptad positions b and f substituted with beta-amino acids
XRMKQLEDKVEELLSKNYHLENEVARLKKLVXER